PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000195431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family VOZ
Protein Properties Length: 346aa    MW: 38301.1 Da    PI: 5.7573
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000195431genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ188.33e-581532771127
            VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                    pp saf +pkcalw+c+rp++    +qd css ha+la neglpg tpvlrp+gi lkdg+lfaal+ k+qgk+vgip c+gaat +spw+ +elf
  MDP0000195431 153 PPASAFKRPKCALWECSRPVHV--LCQDXCSSGHAHLARNEGLPGKTPVLRPWGIALKDGSLFAALNDKTQGKDVGIPDCDGAATLRSPWDDPELF 246
                    789*****************86..6*********************************************************************** PP

            VOZ  97 dlsllegetirewlffdkprrafesgnrkqr 127
                    dl l eget rewlff +prrafesgnrk+r
  MDP0000195431 247 DLFLHEGETPREWLFFGRPRRAFESGNRKRR 277
                    *****************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTKESKGKCE AASHKLLKEK AKTRVQKLRG MFTNIQIARK EGRTADMAIF EDQMDQMLGG  60
WIAELNDPSI ASSLHGGSXG RLESFSDDLA RFSKQQCDEK DDAESPLKDL PQPNLEGPEP  120
EDFIVSFKGP PEDXFQDLEF PDVVPDVMPD ICPPASAFKR PKCALWECSR PVHVLCQDXC  180
SSGHAHLARN EGLPGKTPVL RPWGIALKDG SLFAALNDKT QGKDVGIPDC DGAATLRSPW  240
DDPELFDLFL HEGETPREWL FFGRPRRAFE SGNRKRRLEL KFGTAKKSSK GKQSNDPVGR  300
LTAEASTEVG NNSKXTTSKN AEAGNIFGSD NQTNSLYLNP EMSWKC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.112081e-116bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342960.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ07e-83VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM5WU259e-97M5WU25_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g00500.t012e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.24e-84vascular plant one zinc finger protein